Skip to main content

SAE2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-34070PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-34070PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBA2.

Source: E. coli

Amino Acid Sequence: DFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDSSNNAD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34070.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-34070PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SAE2

Covalent attachment of one protein to another is one of the more prominent posttranslational modifications in respect to size and ubiquity. Ubiquitin is the most familiar of the protein modifiers and its activation and transfer to target proteins has been studied extensively. Recently, a new group of ubiquitin-like proteins has been receiving a lot of attention. SUMO, or Sentrin, is one of the most intriguing. SUMO has been implicated in the stabilization of target proteins and/or their localization to sub-cellular complexes. The conjugation of SUMO-1, SUMO-2 and SUMO-3 onto target proteins requires the concerted action of the specific E1-activating enzyme SAE1/SAE2, the E2-conjugating enzyme Ubc9, and an E3-like SUMO ligase.

Alternate Names

Anthracycline-associated resistance ARX, ARX, EC 6.3.2, EC 6.3.2.-, FLJ13058, HRIHFB2115, SAE2SUMO-1 activating enzyme subunit 2, SUMO1 activating enzyme subunit 2, SUMO-activating enzyme subunit 2, UBA2, ubiquitin-activating enzyme E1 homolog, Ubiquitin-like 1-activating enzyme E1B, ubiquitin-like modifier activating enzyme 2, UBLE1B

Gene Symbol

UBA2

Additional SAE2 Products

Product Documents for SAE2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SAE2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...