S5a/Angiocidin Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-37888PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-37888PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: S5a/Angiocidin
S5a/Angiocidin, also known as Anti-secretory Factor (ASF), is classified under the gene PSMD4, but is often referred to by a different name depending on the context in which it is described. S5a and ASF have identical 377 amino acid (aa) sequences, while Angiocidin is described as having an additional Gly255Glu256Arg257 sequence in its C-Terminus. The human protein shares 96% and 99% aa sequence identity with its mouse and rat orthologs, respectively. Structurally, it contains an N-terminal von Willebrand Factor type A domain and two C-terminal Ubiquitin-interacting motifs (UIM). It acts as a Ubiquitin-binding protein where it is most commonly referred to as S5a or in yeast as Rpn10. It is part of the 19S regulatory subunit of the 26S Proteasome where its UIM recognizes poly-ubiquitinated proteins destined for degradation. As a part of the proteasome complex, it may also recognize the Ubiquitin-like modifier FAT10. Free cytoplasmic forms also exist where its ubiquitination is catalyzed by a range of Ubiquitin E3 ligases from different classes. Therefore, experimentally S5a/Angiocidin may act as a useful substrate to monitor the activity of (E3) ligases, independent of their specific mechanisms of action. In cancer biology, where it is often referred to as Angiocidin, it is shown to slow tumor progression. It is found in the extracellular matrix of certain tumor subtypes, and it may act by suppressing angiogenesis or by directly inhibiting tumor cell growth. It also is found in several biological fluids where it is known primarily as ASF. It suppresses fluid secretion in response to enterotoxin and may act as an anti-inflammatory factor.
Long Name
Alternate Names
Gene Symbol
Additional S5a/Angiocidin Products
Product Documents for S5a/Angiocidin Recombinant Protein Antigen
Product Specific Notices for S5a/Angiocidin Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.