Skip to main content

RRAS Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56964PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56964PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RRAS.

Source: E. coli

Amino Acid Sequence: LESQRQVPRSEASAFGASHHVAYFEASAKL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56964.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56964PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RRAS

R-Ras is a member of the Ras superfamily of GTPases. Ras proteins function as signaling focal points that are activated by convergent signaling pathways intiated by extracellular stimuli (reviewed in Mitin et al, 2005). Activated Ras proteins in turn regulate a diversity of downstream cytoplasmic signaling cascades. Many members of the Ras superfamily are implicated in the regulation of hematopoietic cells, with roles in growth, survival, differentiation, cytokine production, chemotaxis, vesicle-trafficking, and phagocytosis. The Ras superfamily of proteins includes over 150 small GTPases (distinguished from the large, heterotrimeric GTPases, the G-proteins). It comprises six subfamilies, the Ras, Rho, Ran, Rab, Arf, and Kir/Rem/Rad subfamilies. They exhibit considerable overall amino acid identities, especially in the regions interacting with the guanine nucleotide exchange factors that catalyze their activation. Recognizes R-Ras; human R-Ras is a 218 amino acid protein.

Alternate Names

Oncogene RRAS, p23, ras-related protein R-Ras, related RAS viral (r-ras) oncogene homolog

Gene Symbol

RRAS

Additional RRAS Products

Product Documents for RRAS Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RRAS Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...