Skip to main content

RNA polymerase I termination factor Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38740PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38740PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TTF1.

Source: E. coli

Amino Acid Sequence: VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38740.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38740PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RNA polymerase I termination factor

The TTF1 gene encodes a 905 amino acid long, 103 kDA transcription termination factor 1 protein, also known as a RNA polymerase I termination factor, which functions in terminating ribosomal gene transcription. Additionally, it regulates fork arrest replication and RNA polymerase I transcription on chromatin. Through monitoring the activation as well as the silencing of rDNA transcription, TTF1 acts in rDNA regulation. TTF1 functions in RNA polymerase I transcription as well as mitochondrial transcription and gene expression. It is known to interact with genes PTRF, NFATC3, BAZ2A, SMAD1, and SMAD7. TTF1 has been researched regarding its role in lung cancer, small cell carcinoma, sex cord-gonadal stromal tumor, thyroiditis, blastoma, adenocarcinoma, desmoplastic small round cell tumors, and hirschsprung's disease.

Alternate Names

RNA polymerase I termination factor, transcription termination factor 1, Transcription termination factor I, transcription termination factor, RNA polymerase I, TTF-1, TTF-I

Gene Symbol

TTF1

Additional RNA polymerase I termination factor Products

Product Documents for RNA polymerase I termination factor Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RNA polymerase I termination factor Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...