Skip to main content

RENBP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80851PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-80851PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RENBP.

Source: E. coli

Amino Acid Sequence: RILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80851.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-80851PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RENBP

RENBP, also known as N-acylglucosamine 2-epimerase, is a 49kDa 427 amino acid protein with a shorter 29kDa 254 isoform produced by alternative splicing. RENBP functions as a catalyzer in the conversion of N-acetylglucosamine to N-acetylmannosamine. Current research is being conducted on RENBP in relation to sialuria, Wilms tumor, allergic rhinitis, myopathy, vascular disease, hypertension, nephropathy, proteinuria and aldosteronism. RENBP has been linked to the amino sugar and nucleotide sugar metabolism pathways where it interacts with HEXA, HEXB, GNE, REN and ZBED1.

Alternate Names

AGE, EC 5.1.3.8, GlcNAc 2-epimerase, N-acetyl-D-glucosamine 2-epimerase, N-acylglucosamine 2-epimerase, RBP, renin binding protein, Renin-binding protein, RNBP

Gene Symbol

RENBP

Additional RENBP Products

Product Documents for RENBP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RENBP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...