Recombinant Human CD44v6 Fc Chimera Protein, CF
Catalog # 11175-CD | R&D Systems, Inc. a Bio-Techne Brand
Key Product Details
Accession #
Source
Structure / Form
Conjugate
Applications
Product Specifications
Source
Human CD44v6 (Gln21-Thr222) (IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG)(Asp224-Trp269) Accession # NP_001001391.1 |
GGIEGRMD | Human IgG1 (Pro100-Lys330) |
N-terminus | C-terminus |
Purity
Endotoxin Level
N-terminal Sequence Analysis
Predicted Molecular Mass
SDS-PAGE
Activity
When Recombinant Human CD44v6 Fc Chimera (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.
Scientific Data Images for Recombinant Human CD44v6 Fc Chimera Protein, CF
Recombinant Human CD44v6 Fc Chimera Protein Binding Activity.
When Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) is immobilized at 1 µg/mL (100 µL/well), Biotinylated Hyaluronan binds with an ED50 of 4.00-40.0 ng/mL.Recombinant Human CD44v6 Fc Chimera Protein SDS-PAGE.
2 μg/lane of Recombinant Human CD44v6 Fc Chimera Protein (Catalog # 11175-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands at 105-120 kDa and 210-240 kDa, respectively.Formulation, Preparation and Storage
11175-CD
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. |
Reconstitution | Reconstitute at 500 μg/mL in PBS. |
Shipping | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
|
Background: CD44
References
- Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
- Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
- Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
- Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
- Todaro, M. et al. (2014) Cell stem cell 14:342.
- Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
- Ma, L. et al. (2019) Cell Death Dis. 10:30.
- Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
- Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
- Nakamura, H. et al. (2004) Cancer Res. 64:876.
- Murakami, D. et al. (2003) Oncogene 22:1511.
- Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.
Alternate Names
Gene Symbol
UniProt
Product Documents for Recombinant Human CD44v6 Fc Chimera Protein, CF
Product Specific Notices for Recombinant Human CD44v6 Fc Chimera Protein, CF
For research use only
Reconstitution Calculator
The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.