Skip to main content

Proprotein Convertase 1/PCSK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17642PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17642PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Proprotein Convertase 1/PCSK1

Source: E. coli

Amino Acid Sequence: EGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17642.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17642PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Proprotein Convertase 1/PCSK1

Proprotein Convertase 1, also known as PCSK1, PC1 or PC3, is a serine protease in the Furin family. Autocatalytic processing results in the removal of the pro peptide as well as a region from the C-terminus, which leads to the production of the most active 66 kDa form. PCSK1 is predominantly expressed in endocrine and neural cells and is stored in dense-core secretory vesicles, PCSK1 processes several endocrine and neural prohormones, including opiomelanocortin, somatostatin, enkephalin, insulin, dynorphin, and thyrotropin-releasing hormone. PCSK1 mutations are assiciated with obesity and impaired prohormone processing.

 

Alternate Names

NEC1, PCSK1

Gene Symbol

PCSK1

Additional Proprotein Convertase 1/PCSK1 Products

Product Documents for Proprotein Convertase 1/PCSK1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Proprotein Convertase 1/PCSK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...