Skip to main content

PPIG Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49256PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-49256PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIG.

Source: E. coli

Amino Acid Sequence: QRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKNEKEKKVKDHKSNSKERDIRRNSEKEDKYKNKVKKRAKSKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49256.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49256PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PPIG

SR cyclophilin (SRcyp) is also known as peptidyl-prolyl cis-trans isomerase G. Cyclophilins are peptidyl-prolyl isomerases (PPIases) that accelerate the folding of proteins by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. The function of cyclophilins is poorly understood, but their function has been linked to multiple cellular processes such as protein folding, trafficking, and chaperone activity. SRcyp is a member of the Moca family of nuclear cyclophilins and is phosphorylated in a cell cycle dependent manner. There is evidence that SRcyp may be involved in the regulation of gene expression and mRNA splicing. Alternative names for SRcyp include PPIase G, rotamase G, cyclophilin G, clk-associating RS-cyclophilin, CARS-cyclophilin, SR-cyp, CASP10, and PPIG.

Alternate Names

CARS-cyclophilin, CARS-CypPPIase G, CASP10, Clk-associating RS-cyclophilin, Cyclophilin G, CYP, EC 5.2.1.8, MGC133241, peptidyl-prolyl cis-trans isomerase G, Peptidyl-prolyl isomerase G, peptidylprolyl isomerase G (cyclophilin G), peptidyl-prolyl isomerase G (cyclophilin G), Rotamase G, SCAF10, SR-cyclophilin, SRcyp, SR-cyp, SR-related CTD-associated factor 10

Gene Symbol

PPIG

Additional PPIG Products

Product Documents for PPIG Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPIG Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...