Skip to main content

PLBD1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-37893PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-37893PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLBD1.

Source: E. coli

Amino Acid Sequence: WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37893.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-37893PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PLBD1

PLBD1, also known as Phospholipase B-like 1, is a 553 amino acid protein that is 63 kDa, cytoplasmic granule subcellular location, commonly found expressed in neutrophils and monocytes; acts on various phospholipids including phosphatidylcholine, phosphatidylinositol, phosphatidylethanolamine, and lysophospholipids; participates in the generation of lipid mediators of inflammation with an important role in defense against invading microorganisms. This protein has been shown to have interactions with SLC747, IGSF6, TYROBP, and GPCDD1 in pathways such as acyl chain remodeling of PE, acyl chain remodelling of PC, hydrolysis of LPC, phospholipid metabolism, acyl chain remodelling of PI, glycerophospholipid biosynthesis, and metabolism of lipids and lipoproteins.

Alternate Names

EC 3.1.1, EC 3.1.1.-, FLJ22662, LAMA-like protein 1, Lamina ancestor homolog 1, phospholipase B domain containing 1, Phospholipase B domain-containing protein 1, PLB homolog 1, putative phospholipase B-like 1

Gene Symbol

PLBD1

Additional PLBD1 Products

Product Documents for PLBD1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PLBD1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...