Recombinant Human PIGA GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00005277-Q01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
Western Blot, ELISA, Affinity Purification, Microarray
Product Specifications
Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 194-293 of Human PIGA
Source: Wheat Germ (in vitro)
Amino Acid Sequence: LRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHK
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human PIGA GST (N-Term) Protein
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00005277-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: PIGA
Alternate Names
class A GlcNAc-inositol phospholipid assembly protein, EC 2.4.1.198, GlcNAc-PI synthesis protein, GPI anchor biosynthesis, GPI3, phosphatidylinositol glycan anchor biosynthesis, class A, phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria), phosphatidylinositol N-acetylglucosaminyltransferase subunit A, Phosphatidylinositol-glycan biosynthesis class A protein, phosphatidylinositol-glycan biosynthesis, class A protein, PIG-A
Gene Symbol
PIGA
Additional PIGA Products
Product Documents for Recombinant Human PIGA GST (N-Term) Protein
Product Specific Notices for Recombinant Human PIGA GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...