Skip to main content

PHIP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-33883PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-33883PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHIP.

Source: E. coli

Amino Acid Sequence: NALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDLLQKKNRGGRKPKRKMKTQKLDADLLVPASVKVLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33883.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-33883PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PHIP

PH-interacting protein (PHIP) was isolated as factor that binds to the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS-1). PHIP was determined not to be a substrate of the insulin receptor but may instead serve to link IRS-1 to the insulin receptor. PHIP has also been implicated as a positive regulator of beta-cell mitogenesis and survival. PHIP is also known as WD-repeat-containing protein 11, WDR11, and IRS-1 PH domain-binding protein.

Alternate Names

DCAF14, DDB1 and CUL4 associated factor 14, FLJ20705, FLJ45918, IRS-1 PH domain-binding protein, MGC90216, ndrp, PH-interacting protein, pleckstrin homology domain interacting protein, WD repeat-containing protein 11, WDR11

Gene Symbol

PHIP

Additional PHIP Products

Product Documents for PHIP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PHIP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...