Skip to main content

PHF15 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55528PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55528PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHF15.

Source: E. coli

Amino Acid Sequence: IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55528.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55528PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PHF15

PHF15, also known as Protein Jade-2, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa and a 562 amino acid isoform that is 63 kDa, has a histone H4-specific acetyltransferase activity as a component of the HBO1complex, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. This protein has been shown an interaction with ING4, KAT7, ING5, PACSIN, ZBTB3, ZBTB5, ZNF496, and VHL proteins in histone H3 acetylation, histone H4-K5 acetylation, histone H4-K8 acetylation, and histone H4-K12 acetylation biological processes.

Alternate Names

PHD finger protein 15KIAA0239JADE2, protein Jade-2

Gene Symbol

PHF15

Additional PHF15 Products

Product Documents for PHF15 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PHF15 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...