Recombinant Mouse OX40 Ligand/TNFSF4 Protein
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-26577
Key Product Details
Conjugate
Unconjugated
Applications
Functional Assay, SDS-PAGE
Product Specifications
Description
A recombinant protein corresponding to TNFSF4.
Amino Acid Sequence:
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Mouse Ig-Fc amino acid sequence, followed by linker (SGR) in bold and
Extracellular mouse OX40L amino acid sequence is underlined
Purity
Protein A purified
Endotoxin Level
Endotoxin level < 0.1 EU/ug of the protein (< 0.01 ng/ug of the protein) as determined by the LAL test.
Predicted Molecular Mass
43.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
In vitro proliferation assay, in vivo assays.This protein was measured by its ability to co-stimulate IL-2 secretion in the presence of anti-mCD3, and agonist antibody OX86.
Applications
Functional (reported in scientific literature (PMID 24633226))
In vitro assay (reported in scientific literature (PMID 24633226))
In vitro assay (reported in scientific literature (PMID 24633226))
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Mouse OX40 Ligand/TNFSF4 Protein
In vitro assay: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]
In vitro assay: TNFSF4 Protein [NBP2-26577] - Demonstration in vitro of the potency of Fc-OX40L in comparison to an agonist antibody OX86, with anti-CD3 alone serving as a negative control for co-stimulation.SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]
SDS-Page: TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-20% reducing SDS-PAGE.SDS-PAGE: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577]
SDS-Page: Recombinant Mouse OX40 Ligand/TNFSF4 Protein [NBP2-26577] - Electrophoretic analysis of Fc-mOX40L using Coomassie blue stained 4-15% reducing SDS-PAGE.Formulation, Preparation and Storage
NBP2-26577
| Formulation | Phosphate-buffered solution, pH 7.2, containing no preservative. 0.2 um filter sterilized. |
| Preservative | No Preservative |
| Concentration | 2 mg/ml |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: OX40 Ligand/TNFSF4
Alternate Names
CD252, gp34, TNFSF4
Gene Symbol
TNFSF4
Additional OX40 Ligand/TNFSF4 Products
Product Documents for Recombinant Mouse OX40 Ligand/TNFSF4 Protein
Product Specific Notices for Recombinant Mouse OX40 Ligand/TNFSF4 Protein
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...