Skip to main content

OS9 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84803PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-84803PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OS9.

Source: E. coli

Amino Acid Sequence: PLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKML

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84803.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-84803PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: OS9

OS9 is a lectin which functions in endoplasmic reticulum quality control and ER-associated degradation. This ER glycoprotein is found in the intralumenal level and highly expressed in tumor tissue. The OS9 gene is transcriptionally induced upon activation of the Ire1/Xbp1 ER-stress pathway.

Functionally, OS9 binds to HIF-1, a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. It may also bind terminally misfolded non-glycosylated proteins as well as improperly folded glycoproteins, retain them in the ER, and possibly transfer them to the ubiquitination machinery and promote their degradation. One such possible target includes TRPV4.

Alternate Names

Amplified in osteosarcoma 9, endoplasmic reticulum lectin 2, ERLEC2, erlectin 2, OS-9, osteosarcoma amplified 9, endoplasmic reticulum associated protein, osteosarcoma amplified 9, endoplasmic reticulum lectin, protein OS-9

Gene Symbol

OS9

Additional OS9 Products

Product Documents for OS9 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for OS9 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...