Skip to main content

Neurabin 1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89857PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89857PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R9A.

Source: E. coli

Amino Acid Sequence: EEPCAESKAMPKSEIPSPQSQLLEDAEANLVGREAAKQQRKELAGGDFTSPDASASSCGKEVPEDSNNFDGSHVYMHSDYNVYRVRSRYNSDWGETGTEQDEEEDSDENSYYQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89857.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89857PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Neurabin 1

Neurabin 1 is a brain-specific protein which contains an F-actin binding domain, a PDZ domain, a transmembrane-protein-interacting-domain, and a coiled-coil region. As its structure suggests, Neurabin 1 is a promiscuous protein binding to F-actin, protein phosphatase 1, TGN38, and p70 S6 kinase. Found exclusively in brain, this protein is highly concentrated in the synapse and has also been shown to be enriched in the lamellipodia of the growth cone during neuronal development. Neurabin 1 appears to be a bridging protein by targeting other proteins to the synapse or by linking membrane proteins to the actin cytoskeleton.

Alternate Names

KIAA1222NRBI, neurabin-1, Neurabin-IFLJ20068, Neural tissue-specific F-actin-binding protein I, NRB1, Protein phosphatase 1 regulatory subunit 9A, protein phosphatase 1, regulatory (inhibitor) subunit 9A

Gene Symbol

PPP1R9A

Additional Neurabin 1 Products

Product Documents for Neurabin 1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Neurabin 1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...