Recombinant Human Nbs1 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00004683-Q01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Affinity Purification, Microarray, SDS-PAGE, Western Blot
Product Specifications
Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 645-754 of Human Nbs1
Source: Wheat Germ (in vitro)
Amino Acid Sequence: DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human Nbs1 GST (N-Term) Protein
SDS-PAGE: Recombinant Human Nbs1 GST (N-Term) Protein [H00004683-Q01]
SDS-Page: Recombinant Human, Nbs1 Protein [H00004683-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue, using Recombinant Human, Nbs1 Protein [H00004683-Q01].Formulation, Preparation and Storage
H00004683-Q01
Preparation Method | in vitro wheat germ expression system |
Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: Nbs1
In DNA double strand break repair, the FHA/BRCT domains bind DNA damage sensor proteins including gamma H2AX (phospho Ser139), phosphorylated MDC1 and CtIP (CtBP-interacting protein). NBS1 then recruits the other members of the MRN complex, Mre11 and Rad50, to the proximity of DNA DSBs. The MRN complex has also been shown to interact with ATM or ATR kinases in the presence of DSBs or replication fork stalling, respectively. Phosphorylation of NBS1 at Ser 278 and Ser343 in response to ionizing radiation (IR) is dependent on ATM and is important for activation of the S phase checkpoint. The activation of ATM in response to DNA damage is also facilitated by MRN and may lead to induction of apoptosis (2, 3).
References
1. Bian L, Meng Y, Zhang M, Li D. (2019) MRE11-RAD50-NBS1 complex alterations and DNA damage response: implications for cancer treatment. Mol Cancer. 26;18(1):169. PMID: 31767017
2. Zhang Y, Zhou J, Lim CU. (2006) The role of NBS1 in DNA double strand break repair, telomere stability, and cell cycle checkpoint control. Cell Res. 16(1):45-54. PMID: 16467875
3. Komatsu K. NBS1 and multiple regulations of DNA damage response. (2016) J Radiat Res. 57 Suppl 1:i11-i17. PMID: 27068998
Long Name
Nijmegen Breakage Syndrome 1
Alternate Names
NBN, Nibrin, p95
Gene Symbol
NBN
Additional Nbs1 Products
Product Documents for Recombinant Human Nbs1 GST (N-Term) Protein
Product Specific Notices for Recombinant Human Nbs1 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
Loading...