Skip to main content

NAPE-PLD Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48571PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48571PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAPE-PLD.

Source: E. coli

Amino Acid Sequence: ELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48571.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48571PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NAPE-PLD

NAPE-PLD (also known as N-Acylphosphatidylethanolamine (NAPE)-hydrolyzing phospholipase D) is a membrane-bound phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine. NAPE-PLD has been shown to be expressed by specific populations of neurons in the brain and targeted to axonal processes. Recent studies have suggested that NAEs generated by NAPE-PLD in axons may act as anterograde synaptic signaling molecules that regulate the activity of postsynaptic neurons. NAPE-PLD has also been shown to catalyze the hydrolysis of NAPE to generate OEA (oleoylethanolamide), a natural lipid amide that inhibits food intake in free-feeding rodents by prolonging latency to feed and postmeal interval.

Long Name

N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Alternate Names

C7orf18, EC 3.1.4.54, NAPEPLD

Gene Symbol

NAPEPLD

Additional NAPE-PLD Products

Product Documents for NAPE-PLD Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NAPE-PLD Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...