Skip to main content

MRPS6 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-30508PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-30508PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS6.

Source: E. coli

Amino Acid Sequence: KQPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNRGGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30508.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-30508PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MRPS6

MRPS6, also known as Mitochondrial Ribosomal Protein S6, consists of a 125 amino acid isoform that is 14 kDa, and is a part of the mitochondrial ribosome small subunit 28S, which is involved in protein synthesis. Current disease research is being conducted on the relationship between MRPS6 and myocardial infarction and gigantism. The protein is linked to the process of translation and interacts with KIAA1377, LRIF1, ICT1, SRRM2, and ESR1.

Alternate Names

C21orf101, mitochondrial ribosomal protein S6, MRP-S6chromosome 21 open reading frame 101, RPMS628S ribosomal protein S6, mitochondrial, S6mt

Gene Symbol

MRPS6

Additional MRPS6 Products

Product Documents for MRPS6 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MRPS6 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...