Skip to main content

MRPL12 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85216PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85216PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPL12.

Source: E. coli

Amino Acid Sequence: VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85216.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85216PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MRPL12

MRPL12, also known as 39 S ribosomal protein L12, mitochondrial, is a 21.3 kDa, 198 amino acid protein that is involved in mitochondrial protein synthesis by forming homodimers in 39S subunits. Current research is being conducted to identify the effect of the protein on diseases such as prostate cancer and prostatitis. The protein interacts in translation pathways with other proteins such as ICT1, MRPL3, SRRM2, PPP2R2B, and TMEM51.

Alternate Names

5c5-2, FLJ60124, L12mt, MGC8610, mitochondrial ribosomal protein L12, MRP-L12, MRP-L31/34, MRPL7, MRPL7/L12, RPML1239S ribosomal protein L12, mitochondrial

Gene Symbol

MRPL12

Additional MRPL12 Products

Product Documents for MRPL12 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MRPL12 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...