Skip to main content

LRIG1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-30926PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-30926PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRIG1.

Source: E. coli

Amino Acid Sequence: TRKKSEEYSVTNTDETVVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30926.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-30926PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LRIG1

LRIG1 (leucine-rich repeat and Ig-like domain-containing-1) is a 145 kDa type I transmembrane glycoprotein that shares 45 - 50% amino acid (aa) identity with two other mammalian LRIG proteins. LRIG1 shows highest expression in subsets of glial cells in brain, and certain epithelia in liver, stomach, small intestine and skeletal muscle. Within the cell, LRIG1 is expressed in the perinuclear region as well as on the surface. LRIG1 binds ErbB receptors and promotes their ubiquitination, internalization and destruction.

Long Name

Leucine-rich Repeats and Immunoglobulin-like Domains 1

Alternate Names

Img, LIG1

Gene Symbol

LRIG1

Additional LRIG1 Products

Product Documents for LRIG1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LRIG1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...