Skip to main content

KLRG1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57506PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-57506PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLRG1.

Source: E. coli

Amino Acid Sequence: LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57506.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57506PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: KLRG1

KLRG1 (killer cell lectin-like receptor G1), also known as CLEC15A and MAFA, belongs to the KLR family. KLRG1 is a lectin-like inhibitory receptor that is a single pass type II transmembrane protein (1). KLRG1 functions in innate immunity and has an inhibitory role on the function of natural killer (NK) cells and T cells that is induced by binding to their non-MHC ligands (1,2). The KLRG1 protein exists as both a monomer and homodimer and is expressed as an inhibitory receptor on NK cells as well as subsets of CD4+ and CD8+ T cells, gammadelta T cells, and alphabeta T cells (1,3,4). The human KLRG1 protein is 195 amino acids (aa) in length with a theoretical molecular weight (MW) of 21.8 kDa (2). Given KLRG1 protein glycosylation and disulfide bonds, the observed molecular weight often ranges from 30-38 kDa. The human KLRG1 protein consists of a cytoplasmic domain at 1-38 aa with one immunoreceptor tyrosine-based inhibitory motif (ITIM) at 5-10 aa, a transmembrane segment at 39-59 aa, and an extracellular domain (ECD) at 60-195 aa with one C-type lectin domain (CTLD) at 82-185 aa (2).

KLRG1's primary ligand is E-cadherin, which is expressed on non-neural epithelial tissues, but the KLRG1 receptor also recognizes both N- and R-cadherin expressed in nervous system tissues (1,3,5,6). E-cadherin binding of KLRG1 leads to ITIM triggering and, ultimately, either reduced T cell proliferation or decreased NK cell cytotoxicity (3,5,6). More precisely, upon differentiation of CD8+ T cells, cells switch from signaling through CD28 and instead signal through the inhibitory KLRG1 receptor molecule (3,4). Phosphorylation of KLRG1's ITIM causes recruitment of two phosphatases, SH2-containing inositol polyphosphate 5-phoshate (SHIP-1) and SH-2 containing protein-tyrosine phosphatase 2 (SHP-2) (3,5). The effectors SHIP-1 and SHP-2 degrade PIP3 to PIP2, preventing Akt phosphorylation and inhibiting proliferation (3,5,6). Conversely, when KLRG1 signaling is blocked in highly differentiated T cells, Akt signaling is restored and cell proliferation resumes (3). An increase in highly differentiated T cells is observed in many age-related infections such as meningitis, pneumonia, and influenza, which also correlates with elevated KLRG1 levels (3). This observation suggests that KLRG1 may be a potential immunotherapeutic target, especially for vaccinations which typically have decreased response in aged patients (3).

References

1. Li Y, Hofmann M, Wang Q, Teng L, Chlewicki LK, Pircher H, Mariuzza RA. Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition. Immunity. 2009 Jul 17;31(1):35-46. http://doi.org/10.1016/j.immuni.2009.04.019

2. Uniprot(Q96E93)

3. Henson SM, Akbar AN. KLRG1--more than a marker for T cell senescence. Age (Dordr). 2009 Dec;31(4):285-91. http://doi.org/10.1007/s11357-009-9100-9.

4. Thimme R, Appay V, Koschella M, Panther E, Roth E, Hislop AD, Rickinson AB, Rowland-Jones SL, Blum HE, Pircher H. Increased expression of the NK cell receptor KLRG1 by virus-specific CD8 T cells during persistent antigen stimulation. J Virol. 2005 Sep;79(18):12112-6.http://doi.org/10.1128/JVI.79.18.12112-12116.2005.

5. Borys SM, Bag AK, Brossay L, Adeegbe DO. The Yin and Yang of Targeting KLRG1+ Tregs and Effector Cells. Front Immunol. 2022 Apr 29;13:894508. http://doi.org10.3389/fimmu.2022.894508.

6. Van den Bossche J, Malissen B, Mantovani A, De Baetselier P, Van Ginderachter JA. Regulation and function of the E-cadherin/catenin complex in cells of the monocyte-macrophage lineage and DCs. Blood. 2012 Feb 16;119(7):1623-33. http://doi.org/10.1182/blood-2011-10-384289.

Long Name

Killer Cell Lectin-like Receptor Subfamily G Member 1

Alternate Names

CLEC15A, MAFA, MAFAL

Gene Symbol

KLRG1

Additional KLRG1 Products

Product Documents for KLRG1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KLRG1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...