Skip to main content

ILT7/CD85g/LILRA4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-48932PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-48932PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ILT7/CD85g/LILRA4.

Source: E. coli

Amino Acid Sequence: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48932.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-48932PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LILRA4/CD85g/ILT7

ILT7 (immunoglobulin-like transcript 7) is a member of leukocyte immunoglobulin-like receptor (LIR or LILR) gene family, also known as CD85g and LILRA4. It contains four extracellular Ig domains. In association with Fc epsilonR1 gamma, ILT7 forms a receptor complex that transduces ITAM-mediated signals. ILT7 is specifically expressed on plasmacytoid dendritic cells (pDCs), but not on myeloid dendritic cells and other peripheral blood leukocytes. ILT7 negatively regulates the innate immune functions of human pDCs. Cross-linking 17G10.2 antibody is able to trigger ILT7 mediated signaling.

Long Name

Leukocyte Immunoglobulin-like Receptor, Subfamily A (with TM domain), Member 4

Alternate Names

CD85g, ILT7

Gene Symbol

LILRA4

Additional LILRA4/CD85g/ILT7 Products

Product Documents for ILT7/CD85g/LILRA4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ILT7/CD85g/LILRA4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...