IL-36 gamma/IL-1F9 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24913PEP
Key Product Details
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-36 gamma/IL-1F9
Source: E.coli
Amino Acid Sequence: AFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
>80% by SDS-PAGE and Coomassie blue staining
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24913It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP3-24913PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: IL-36 gamma/IL-1F9
Interleukin 36 gamma (IL-36 gamma), also known as IL-1F9 and IL-1H1 is a member of the IL-1 family. IL-36 gamma is secreted when transfected into 293-T cells. Cells reported to express IL-36 gamma include Langerhans cells, keratinocytes/stratified squamos epithelium, chief cells, and parietal cells. The receptor for IL-36 gamma is reported to be a combination of IL-1 R6/IL-1 R rp2 and IL-1 R3/IL-1 R AcP. Recombinant IL-36 gamma has been shown to activate pathways involving NF-kappa B and MAPK in an IL-1 R6/IL-1 R rp2-dependent manner.
Long Name
Interleukin 36 gamma/Interleukin 1 Family 9
Alternate Names
IL-1 H1, IL-1rp2, IL1F9, IL36 gamma, IL36G
Gene Symbol
IL36G
Additional IL-36 gamma/IL-1F9 Products
Product Documents for IL-36 gamma/IL-1F9 Recombinant Protein Antigen
Product Specific Notices for IL-36 gamma/IL-1F9 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...