Skip to main content

IL-36 beta/IL-1F8 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83892PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-83892PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL36B.

Source: E. coli

Amino Acid Sequence: PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83892.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83892PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-36 beta/IL-1F8

Interleukin 36 beta (IL-36 beta), also known as IL-1F8, FIL-1h and IL-1H2, is a member of the IL-1 family of proteins. IL-36 beta is reported to be actively secreted. Cells expressing IL-36 beta include resting and activated monocytes, and B cells. The receptor for IL-36 beta is thought to be a combination of IL-1 Rrp2 and IL-1 RAcP. Recombinant IL-36 beta activates pathways involving NF-kB and MAPK in an IL-1 Rrp2-dependent manner.

Long Name

Interleukin 36 beta/Interleukin 1 Family 8

Alternate Names

FIL1 eta, IL-1 eta, IL-1H2, IL1F8, IL36 beta, IL36B

Gene Symbol

IL36B

Additional IL-36 beta/IL-1F8 Products

Product Documents for IL-36 beta/IL-1F8 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for IL-36 beta/IL-1F8 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...