Skip to main content

Glypican 3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85226PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-85226PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPC3.

Source: E. coli

Amino Acid Sequence: DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85226.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85226PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Glypican 3

The Glypican 3 (GPC3) gene encodes for a member of the glypican-related integral membrane proteoglycan family (GRIPS). Two isoforms of the protein exist, isoform 1 at a length of 580 amino acids long and 65 kDA while isoform 2 is 526 amino acids long at 59 kDA. The protein encoded by GPC3 is thought to prevent the dipeptidyl peptidase activity of DPP4 and may participate in the suppression and regulation of growth in the predominately mesodermal tissues and organs. The GPC3 gene participates in the Wnt signaling pathway, metabolism, and visual phototransduction through interactions with genes FGF2, WNT3A, WNT7B, BCAN, and BGN. GPC3 has been researched in various diseases such as paine syndrome, horner's sundrome, liver cirrhosis, simpson-golabi-behmel syndrome, germ cell tumors, wilms tumors, complex regional pain syndrome, and hepatocellulcar carcinoma.

Alternate Names

GPC3

Gene Symbol

GPC3

Additional Glypican 3 Products

Product Documents for Glypican 3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glypican 3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...