Skip to main content

Glutamine Synthetase Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-46643PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-46643PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLUL.

Source: E. coli

Amino Acid Sequence: LQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46643.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-46643PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Glutamine Synthetase

Glutamine synthetase is part of the glutamine synthetase family. Specifically, Glutamine synthetase catalyzes the condensation of glutamate and ammonia to form glutamine, during the metabolism of nitrogen. Ammonia incorporation in animals occurs through the actions of glutamate dehydrogenase and glutamine synthase. Glutamate plays the central role in mammalian nitrogen flow, serving as both a nitrogen donor and nitrogen acceptor.

Glutamine synthetase antibodies are useful tools for studying nitrogen metabolism and regulation.

Alternate Names

cell proliferation-inducing protein 59, EC 4.1.1.15, EC 6.3.1.2, GLNSPIG59, Glutamate decarboxylase, glutamate-ammonia ligase, Glutamate--ammonia ligase, glutamate-ammonia ligase (glutamine synthase), glutamine synthase, glutamine synthetase, GS, PIG43, proliferation-inducing protein 43

Gene Symbol

GLUL

Additional Glutamine Synthetase Products

Product Documents for Glutamine Synthetase Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Glutamine Synthetase Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...