Furin Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21314PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: SEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETI
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP3-21314PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Furin
Proteolytic cleavage regulates several physiological processes in both health and disease (3). Abnormal activity or mutations in proteases, including furin, is associated with pathologies and diseases including cancer, cardiovascular disorders, diabetes, inflammation, neurological diseases, and autoimmune diseases (3). As mentioned above, furin also acts upon bacterial substrates, including anthrax and Shiga toxin, and many virus families such as Herpes-, Flavi-, and Corona-, leading to host infections. Furthermore, the novel coronavirus disease 2019 (COVID-19) is caused by severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) present with a S-spike protein that is cleaved by PCs, including furin, at the S1/S2 cleavage site (5, 6). The cleavage allows the SARS-CoV-2 to then attach to the angiotensin-converting enzyme 2 (ACE2) receptor via the S1 domain and the cellular membrane via the S2 domain (5, 6). Although COVID-19 patients mostly present with respiratory symptoms, a variety of other systems are affected including cardiovascular, gastrointestinal (GI), and the liver (5-7). It is suggested that the S1/furin/ACE2 interaction promotes SARS-CoV-2 infection leading to the harmful symptoms and reactions in patients (5, 6). Cardiovascular disease is a common comorbidity in patients, along with hypertension, myocardial damage, and heart palpitations (Ming). Further evidence of furin being a risk factor for infection is the high levels of furin present in the blood of heart failure patients (5). Similarly, the small bowel may be another interaction site for infection as it is rich in furin and the intestinal enterocytes have many ACE2 receptors (6). Furin is also highly expressed in the liver and hepatocytes and cholangiocytes of the liver present ACE2 receptors (3, 7). Studies have shown that up one-third of COVID-19 patients experience GI symptoms which range from diarrhea and loss of appetite to abdominal cramping and bloody stool (6, 7). Additionally, some patients displayed abnormal liver enzyme levels (7). It has been suggested that a possible therapeutic strategy for treating those infected with SARS-CoV-2 is pharmacologically or immunologically modulating furin or ACE2 binding sites to combat COVID-19 infection (3, 5).
References
1. Thomas, G. (2002). Furin at the cutting edge: from protein traffic to emryogenesis and disease. Nature Rev. Mol. Cell Biol. https://doi.org/10.1038/nrm934
2. Zhou A., Paquet, L., & Mains, R.E. (1995). Structural elements that direct specific processing of different mammalian subtilisin-like prohormone convertases. J Biol Chem. https://doi.org/10.1074/jbc.270.37.21509
3. Braun E., & Sauter, D. (2019). Furin-mediated protein processing in infectious diseases and cancer. Clin Transl Immunology. https://doi:10.1002/cti2.1073
4. Atlas of Genetics and Cytogenetics in Oncology and Haematology, FURIN
5. Ming, Y. & Qiang, L. (2020). Involvement of Spike Protein, Furin, and ACE2 in SARS-CoV-2-Related Cardiovascular Complications. SN Compr. Clin. Med. https://doi.org/10.1007/s42399-020-00400-2
6. Monkemuller, K., Fry, L., & Rickes, S. (2020). COVID-19, coronavirus, SARS-CoV-2 and the small bowel. Rev Esp Enferm Dig. https://doi:10.17235/reed.2020.7137/2020
7. Agarwal, A., Chen, A., Ravindran, N., To, C., & Thuluvath, P.J. (2020). Gastrointestinal and Liver Manifestations of COVID-19. J Clin Exp Hepatol. https://doi:10.1016/j.jceh.2020.03.001
Alternate Names
Gene Symbol
Additional Furin Products
Product Documents for Furin Recombinant Protein Antigen
Product Specific Notices for Furin Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.