Skip to main content

FRAS1 (Fraser syndrome 1) Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38656PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38656PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FRAS1.

Source: E. coli

Amino Acid Sequence: IWIQLNYLPSYGTLLRISGSEVEELSEVSNFTMEDINNKKIRYSAVFETDGHLVTDSFYFSVSDMDHNHLDNQIFTIMITPAENPPPVIAFADLITVDEGGRAPLSFHHFFATDDDDNLQRDAIIKLSALPKYGCIENTGTGDRFG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38656.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38656PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FRAS1 (Fraser syndrome 1)

Found in a linear fashion underlying the epidermis and the basal surface of other epithelia in embryos. Highly expressed in the apical ectodermal ridge of the limb buds from E10.5-E12.5 and expression was also detected in the interdigital spaces at E14.5. Found in cells just underlying the surface epithelium of the entire embryo and in the linings of the peritoneal cavity and dorsal aorta. At E12 detected in the mesonephric duct and in the lens.

Alternate Names

DKFZp686I05113, extracellular matrix protein FRAS1, FLJ14927, FLJ22031, Fraser syndrome 1, KIAA1500DKFZp686P08111

Gene Symbol

FRAS1

Additional FRAS1 (Fraser syndrome 1) Products

Product Documents for FRAS1 (Fraser syndrome 1) Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for FRAS1 (Fraser syndrome 1) Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...