Skip to main content

Folliculin Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89983PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89983PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FLCN.

Source: E. coli

Amino Acid Sequence: VGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89983.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89983PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Folliculin

Belonging to the folliculin family, this gene is involved in the regulation of protein phosphorylation and protein binding. Located on chromosome 17 within the Smith-Magenis region, folliculin is a possible tumor suppressor gene associated with hereditary renal carcinoma. Mutations in this gene are associated with Birt-Hogg Dube syndrome. Folliculin may play a role in the pathogenesis of kidney cancer. Additionally, this gene may be involved in colorectal tomorigenesis and is also known to be involved in energy and nutrient sensing through the AMPK and mTOR signaling pathways. Common diseases associated with this gene include renal-cell carcinoma, colorectal cancer, renal cancer, Birt-Hogg-Dube syndrome and primary spontaneous pneumothorax.

Alternate Names

BHD skin lesion fibrofolliculoma protein, BHDFLCL, Birt-Hogg-Dube syndrome protein, DKFZp547A118, FLJ45004, FLJ99377, folliculin, MGC17998, MGC23445

Gene Symbol

FLCN

Additional Folliculin Products

Product Documents for Folliculin Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Folliculin Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...