Skip to main content

Exostosin-like 2/EXTL2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56467PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-56467PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Exostosin-like 2/EXTL2.

Source: E. coli

Amino Acid Sequence: TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56467.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56467PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Exostosin-like 2/EXTL2

Exostosin-like 2, or EXTL2 can be found in the extracellular region of the endoplasmic reticulum and is integral to the membrane. Belonging to the glycosyltransferase 47 family, EXTL2 encodes 4-N-acetylhexosamynyltransferase and transfers N-acetylglucosamine to the glycosaminoglycan (GAG) protein linkage region. More specifically, EXTL2 is critical for the synthesis of heparin/heparan sulfate, and the lack of EXTL2 can cause GAG overproduction. Biological processes associated with EXTL2 include the N-acetylglucosamine metabolic process, heparan sulfate proteoglycan biosynthetic process and UDP-N-acetylgalactosamine metabolic process. Known diseases for EXTL2 include Exostosis and hereditary multiple exostoses.

Alternate Names

Exostosin like 2, EXTL2

Gene Symbol

EXTL2

Additional Exostosin-like 2/EXTL2 Products

Product Documents for Exostosin-like 2/EXTL2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Exostosin-like 2/EXTL2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...