Recombinant Human ERAS GST (N-Term) Protein

Name: Recombinant Human ERAS GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00003266-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00003266-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all ERAS Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-233 of Human ERAS

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MELPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGCSVA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

51.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ERAS GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003266-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: ERAS

ERAS belongs to the small GTPase superfamily. Ras family. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. The ERas gene is expressed in embryonic stem (ES) cells and promotes their in vitro proliferation and tumorigenicity. ERas-null ES cells maintain pluripotency but show significantly reduced growth and tumorigenicity, which are rescued by expression of ERas complementary DNA or by activated phosphatidylinositol-3-OH kinase.

Alternate Names

Embryonic stem cell-expressed Ras, E-Ras, ES cell expressed Ras, HRAS2MGC126693, HRASPGTPase ERas, MGC126691, small GTPase protein E-Ras, v-Ha-ras Harvey rat sarcoma viral oncogene homolog 2, v-Ha-ras Harvey rat sarcoma viral oncogene homolog pseudogene

Gene Symbol

ERAS

Additional ERAS Products

Product Documents for Recombinant Human ERAS GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human ERAS GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews