Skip to main content

DUSP7 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17836PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17836PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DUSP7

Source: E. coli

Amino Acid Sequence: AMPCKSAEWLQEELEARGGASLLLLDCRPHELFESSHIET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17836.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17836PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DUSP7

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-basedprotein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosineand serine/threonine residues. DUSP7 belongs to a class of DUSPs, designated MKPs, that dephosphorylate MAPK(mitogen-activated protein kinase) proteins ERK (see MIM 601795), JNK (see MIM 601158), and p38 (see MIM 600289) withspecificity distinct from that of individual MKP proteins. MKPs contain a highly conserved C-terminal catalytic domainand an N-terminal Cdc25 (see MIM 116947)-like (CH2) domain. MAPK activation cascades mediate various physiologicprocesses, including cellular proliferation, apoptosis, differentiation, and stress responses (summary by Patterson etal., 2009 (PubMed 19228121)).(supplied by OMIM)

Alternate Names

DKFZp586F2224, dual specificity phosphatase 7, Dual specificity protein phosphatase PYST2, dual-specificity phosphatase-7, EC 3.1.3.16, EC 3.1.3.48, MKPX, MKP-X, PYST2dual specificity protein phosphatase 7

Gene Symbol

DUSP7

Additional DUSP7 Products

Product Documents for DUSP7 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DUSP7 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...