Skip to main content

Recombinant Human Cytokeratin 3 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003850-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00003850-Q01-25ug
H00003850-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 232-289 of Human Cytokeratin 3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32.12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Cytokeratin 3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Cytokeratin 3 GST (N-Term) Protein [H00003850-Q01]

SDS-PAGE: Recombinant Human Cytokeratin 3 GST (N-Term) Protein [H00003850-Q01]

SDS-Page: Recombinant Human Cytokeratin 3 Protein [H00003850-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003850-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Cytokeratin 3

The protein encoded by the Cytokeratin 3 gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmann's Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. (provided by RefSeq)

Alternate Names

CK3, CK-3, Cytokeratin-3, FLJ95909, K3cytokeratin 3, keratin 3, keratin, type II cytoskeletal 3,65 kDa cytokeratin, Keratin-3, Type-II keratin Kb3

Gene Symbol

KRT3

Additional Cytokeratin 3 Products

Product Documents for Recombinant Human Cytokeratin 3 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Cytokeratin 3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...