Skip to main content

CDC37 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80960PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-80960PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDC37.

Source: E. coli

Amino Acid Sequence: DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80960.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-80960PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CDC37

In S. cerevisiae, Cdc37 has been shown to be an important regulator of cell division cycle through its action on cyclin-dependent kinases (CDK's). Cdc37 has also been associated with signaling pathways and kinases unrelated to cell cycle control, including v-Src, casein kinase II, MPS1 kinase and the sevenless receptor tyrosine kinase. Interestingly, HSP90 has also been shown to be associated with many of the same cellular targets as Cdc37. It has now been shown that Cdc37 is the same protein previously described as p50 which has been found to be associated with many of the same proteins as HSP90. Among others, Cdc37/p50 has been found complexed with Src-family kinases (Fyn, Yes, Fes, Lck & Fgr), Raf and pp60v-src. More recently, Cdc37 has been shown to be a chaperone independently and in concert with HSP90. In fact, Cdc37 is necessary for the binding of HSP90 to Cdk4.

Alternate Names

CDC37 (cell division cycle 37, S. cerevisiae, homolog), CDC37 cell division cycle 37 homolog, CDC37 cell division cycle 37 homolog (S. cerevisiae), CDC37A, cell division cycle 37 homolog (S. cerevisiae), Hsp90 chaperone protein kinase-targeting subunit, hsp90 co-chaperone Cdc37, P50CDC37

Gene Symbol

CDC37

Additional CDC37 Products

Product Documents for CDC37 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CDC37 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...