Skip to main content

Atrial Natriuretic Peptide/ANP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-17073PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-17073PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Atrial Natriuretic Peptide/ANP

Source: E. coli

Amino Acid Sequence: QRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17073.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-17073PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Atrial Natriuretic Peptide/ANP

Atrial natriuretic factor (ANP) is a potent vasoactive substance which is thought to play a key role in cardiovascular homeostasis and has a cGMP stimulating activity. There are two different prepronatriodilatin alleles. One codes for 2 Arginine residues at the C terminus that are cleaved to form the mature peptide, while the other ends in a termination codon immediately after the last codon of the mature peptide. ANP belongs to the natriuretic peptide family.

Alternate Names

ANF, ANP, Cardionatrin, NPPA, PND

Gene Symbol

NPPA

Additional Atrial Natriuretic Peptide/ANP Products

Product Documents for Atrial Natriuretic Peptide/ANP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Atrial Natriuretic Peptide/ANP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...