Skip to main content

AIBZIP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90205PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90205PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CREB3L4.

Source: E. coli

Amino Acid Sequence: ELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLILLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90205.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90205PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: AIBZIP

Androgen-induced basic leucine zipper (AIBZIP)is a transcription factor. AIbZIP is a 395 aa protein with homology to cyclic AMP-responsive element binding protein/activating transcription factor. It contains an NH(2)-terminal activation domain, a central bZIP domain, and a COOH-terminal transmembrane domain. Immunoreactive AIbZIP protein has been detected in the cytoplasm of prostatic luminal epithelial cells; full-length AIbZIP-GFP fusion proteins are localized in the cytoplasm of LNCaP cells, while a truncated form of AIbZIP lacking the putative transmembrane domain was exclusively nuclear. AIbZIP is expressed at higher levels in cancerous prostate cells compared with noncancerous prostate cells.

Alternate Names

AIbZIP, AIBZIPcAMP-responsive element-binding protein 4, Androgen-induced basic leucine zipper protein, ATCE1JAL, Attaching to CRE-like 1, cAMP responsive element binding protein 1, cAMP responsive element binding protein 3-like 4, CREB3, CREB4CREB-4, cyclic AMP-responsive element-binding protein 3-like protein 4, Cyclic AMP-responsive element-binding protein 4, hJALcAMP-responsive element-binding protein 3-like protein 4, tisp40, Transcript induced in spermiogenesis protein 40

Gene Symbol

CREB3L4

Additional AIBZIP Products

Product Documents for AIBZIP Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for AIBZIP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...