Skip to main content

Recombinant Human 5-HT1E GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003354-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00003354-Q01-25ug
H00003354-Q01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 206-276 of Human 5-HT1E

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33.55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human 5-HT1E GST (N-Term) Protein

SDS-PAGE: Recombinant Human 5-HT1E GST (N-Term) Protein [H00003354-Q01]

SDS-PAGE: Recombinant Human 5-HT1E GST (N-Term) Protein [H00003354-Q01]

SDS-Page: Recombinant Human 5-HT1E Protein [H00003354-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003354-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: 5-HT1E

5HT1E Receptor, also known as 5-hydroxytryptamine receptor 1E, is a 365 amino acid protein that is 42 kDa, belongs to the G-protein coupled receptor 1 family, has cell membrane intracellular location; commonly found in the cortex, caudate putamen, claustrum, hippocampus, and amygdala; is one of the many different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that plays a role of a neurotransmitter, a hormone, and a mitogen; this receptor activity is mediated by G proteins that inhibit adenylate cyclase activity. The protein is being studied for its involvement in attention deficit hyperactivity disorder, autism spectrum disorder, chronic fatigue syndrome, hermaphroditism, pharyngitis, neuronitis, and skin papilloma. This protein has been linked to the GPCR downstream signaling, GPCR ligand binding, class A/1 (Rhodopsin-like receptors), serotonin receptors, amine ligand-binding receptors, intracellular calcium signaling, signal transduction, G alpha (i) signaling events, neuroactive ligand-receptor interaction, and amine ligand-binding receptors pathways where it interacts with PSMC3, PSMC4, ADORA3, ADORA1, ADRA2A, APP, CCR3 and over 100 other proteins.

Long Name

5-Hydroxytryptamine Receptor 1E

Alternate Names

5HT1E, HTR1E, S31

Gene Symbol

HTR1E

Additional 5-HT1E Products

Product Documents for Recombinant Human 5-HT1E GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human 5-HT1E GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...