XK X-linked Kx blood group Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-93011
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry/ Immunofluorescence, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 59-138 of human XK (NP_066569.1). HRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit XK X-linked Kx blood group Antibody - Azide and BSA Free (NBP2-93011) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for XK X-linked Kx blood group Antibody - Azide and BSA Free
Western Blot: XK X-linked Kx blood group AntibodyAzide and BSA Free [NBP2-93011]
Western Blot: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of extracts of various cell lines, using XK X-linked Kx blood group at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]
Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of U-2 OS cells using XK X-linked Kx blood group at dilution of 1:100. Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: XK X-linked Kx blood group Antibody - Azide and BSA Free [NBP2-93011]
Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP2-93011] - Analysis of C6 cells using XK X-linked Kx blood group at dilution of 1:100. Blue: DAPI for nuclear staining.Applications for XK X-linked Kx blood group Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:200
Western Blot
1:500-1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: XK X-linked Kx blood group
Alternate Names
Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, KX, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1
Gene Symbol
XK
Additional XK X-linked Kx blood group Products
Product Documents for XK X-linked Kx blood group Antibody - Azide and BSA Free
Product Specific Notices for XK X-linked Kx blood group Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov