Tryptase beta-2/TPSB2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88496

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88496
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all Tryptase beta-2/TPSB2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Tryptase beta-2/TPSB2. Peptide sequence: QALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Tryptase beta-2/TPSB2 Antibody - BSA Free

Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-88496]

Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-88496]

Western Blot: Tryptase beta-2/TPSB2 Antibody [NBP2-88496] - Host: Rabbit. Target Name: TPSB2. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for Tryptase beta-2/TPSB2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Tryptase beta-2/TPSB2

Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq]

Alternate Names

EC 3.4.21, EC 3.4.21.59, mast cell tryptase beta II, mast cell tryptase beta III, TPS2, TPS2tryptase beta-2, TPSB2, tryptase beta 2, tryptase beta 2 (gene/pseudogene), tryptase beta II, tryptase beta III, Tryptase beta2, Tryptase beta-2, Tryptase II, tryptase III, Tryptase-2, tryptaseB, tryptaseC, Tryptase-C

Gene Symbol

TPSB2

Additional Tryptase beta-2/TPSB2 Products

Product Documents for Tryptase beta-2/TPSB2 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Tryptase beta-2/TPSB2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.