Skip to main content

TOMM20 Antibody (4F3)

Catalog # H00009804-M01 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
H00009804-M01

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Flow Cytometry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 4F3

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for TOMM20 Antibody (4F3)

Immunogen

TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Localization

Mitochondrion outer membrane; Multi-pass membrane protein

Specificity

TOMM20 - translocase of outer mitochondrial membrane 20 homolog (yeast)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Scientific Data Images for TOMM20 Antibody (4F3)

Western Blot: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody (M01), clone 4F3.Lane 1: TOMM20 transfected lysate(16.3 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: TOMM20 Antibody (4F3) [H00009804-M01] - Analysis of monoclonal antibody to TOMM20 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry: TOMM20 Antibody (4F3) [H00009804-M01] - Upregulation of GAPDH and TOMM20in C6 glioma. A small glioma labeled with an antibody against Tom20. The brightness and contrast have been increased. Image collected and cropped by CiteAb from the following publication (http://www.biomedcentral.com/1756-0500/8/207), licensed under a CC-BY license.

Applications for TOMM20 Antibody (4F3)

Application
Recommended Usage

ELISA

1:100-1:2000

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1:500
Application Notes
Use in FLOW cytometry reported in scientific literature ( PMID 26779811).
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 18 publications using H00009804-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TOMM20

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Alternate Names

KIAA0016Outer mitochondrial membrane receptor Tom20, MAS20, MGC117367, Mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolog, MOM19, TOM20, translocase of outer mitochondrial membrane 20 homolog (yeast), translocase of outer mitochondrial membrane 20 homolog type II

Entrez Gene IDs

9804 (Human)

Gene Symbol

TOMM20

OMIM

601848 (Human)

Product Documents for TOMM20 Antibody (4F3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TOMM20 Antibody (4F3)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...