Skip to main content

TMEM119 Antibody (CL8714)

Catalog # NBP2-76985 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-76985
NBP2-76985-25ul

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 Clone # CL8714

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for TMEM119 Antibody (CL8714)

Immunogen

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Scientific Data Images for TMEM119 Antibody (CL8714)

Immunohistochemistry-Paraffin: TMEM119 Antibody (CL8714) [NBP2-76985] - Analysis in human cerebral cortex and liver tissues. Corresponding TMEM119 RNA-seq data are presented for the same tissues.
Western Blot: TMEM119 Antibody (CL8714) [NBP2-76985] - Analysis in human cell line SH-SY5Y.
Immunocytochemistry/Immunofluorescence: TMEM119 Antibody (CL8714) [NBP2-76985] - Staining of SH-SY5Y cells using the Anti-TMEM119 monoclonal antibody, showing specific staining to the plasma membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Applications for TMEM119 Antibody (CL8714)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

2-10 ug/mL

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

1 ug/mL
Application Notes
For IHC, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Reviewed Applications

Read 1 review rated 5 using NBP2-76985 in the following applications:

Published Applications

Read 1 publication using NBP2-76985 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMEM119

ATF4 is an approximately 38 kDa member of the bzip family of transcription factors. It plays an important role autophagy, the unfolded protein response, and the response to oxygen and nutrient deprivation. These functions are regulated by the dimerization of ATF4 with the leucine zipper protein FIAT. ATF4 contains a basic DNA-binding domain (aa 280-300) and a leucine zipper domain (aa 306-334).

Long Name

Transmembrane Protein 119

Alternate Names

OBIF

Gene Symbol

TMEM119

Product Documents for TMEM119 Antibody (CL8714)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TMEM119 Antibody (CL8714)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...