Skip to main content

TMED9 Antibody

Catalog # NBP1-83193 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-83193
NBP1-83193-25ul

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for TMED9 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHS

Predicted Species

Mouse (100%). Backed by our 100% Guarantee.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TMED9 Antibody

Western Blot: TMED9 Antibody [NBP1-83193] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: TMED9 Antibody [NBP1-83193] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: TMED9 Antibody [NBP1-83193] - Analysis in human cell line HDLM-2.

Applications for TMED9 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TMED9

Alternate Names

Glycoprotein 25L2, GP25L2, gp25L2 protein, HSGP25L2G, transmembrane emp24 domain-containing protein 9, transmembrane emp24 protein transport domain containing 9

Gene Symbol

TMED9

Product Documents for TMED9 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TMED9 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...