Skip to main content

TFF3 Antibody (3D9), Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # H00007033-M01

Catalog #
Availability
Size / Price
Qty
Loading...
H00007033-M01

Key Product Details

Species Reactivity

Validated:

Human

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3D9

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for TFF3 Antibody (3D9)

Immunogen

TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Specificity

TFF3 - trefoil factor 3 (intestinal)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for TFF3 Antibody (3D9)

Immunohistochemistry-Paraffin: TFF3 Antibody (3D9) [H00007033-M01] - Analysis of monoclonal antibody to TFF3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
ELISA: TFF3 Antibody (3D9) [H00007033-M01] - Detection limit for recombinant GST tagged TFF3 is approximately 0.03ng/ml as a capture antibody.

Applications for TFF3 Antibody (3D9)

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

3 ug/ml

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 22516806).
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 9 publications using H00007033-M01 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: TFF3

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Long Name

Trefoil Factor 3

Alternate Names

ITF, TFI

Entrez Gene IDs

7033 (Human)

Gene Symbol

TFF3

OMIM

600633 (Human)

Additional TFF3 Products

Product Documents for TFF3 Antibody (3D9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TFF3 Antibody (3D9)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...