Skip to main content

TCF20 Antibody

Catalog # NBP2-31968 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-31968
NBP2-31968-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for TCF20 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRLNASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVS

Predicted Species

Rat (90%). Backed by our 100% Guarantee.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for TCF20 Antibody

Immunocytochemistry/Immunofluorescence: TCF20 Antibody [NBP2-31968] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TCF20 Antibody [NBP2-31968] - Staining of human cerebellum shows distinct cytoplasmic and nuclear positivity in Purkinje cells.

Applications for TCF20 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: TCF20

The protein encoded by the TCF20 gene binds a platelet-derived growth factor-responsive element in the matrix metalloproteinase 3 (stromelysin 1) promoter. The protein localizes to the nucleus and displays DNA-binding and transactivation activities. It is thought to be a transcriptional coactivator, enhancing the activity of transcription factors such as JUN and SP1. Alternative splicing results in two transcript variants encoding different isoforms. (provided by RefSeq)

Alternate Names

AR1, SPBP, transcription factor 20, transcription factor 20 (AR1)

Gene Symbol

TCF20

UniProt

Product Documents for TCF20 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TCF20 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for TCF20 Antibody

Showing  1 - 1 of 1 FAQ Showing All
  • Q: The datasheet says that the concentration of NBP2-31968 varies between lots, would you please help check and suggest the info about the latest lot?

    A: Lot# R33995 is the current lot of TCF20 Antibody [NBP2-31968] and for this lot, the concentration is 0.2 mg/ml. This product is guaranteed for IHC-P and ICC-IF applications and the customer can see the suggested dilutions on the datasheet.

Showing  1 - 1 of 1 FAQ Showing All
Loading...