Skip to main content

Novus Biologicals products are now on bio-techne.com

Better as one

Syndecan-4 Antibody, Novus Biologicals

Bio-Techne includes Novus Biologicals | Catalog # NBP1-90173

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-90173
NBP1-90173-25ul

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for Syndecan-4 Antibody

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV

Marker

Plasma Membrane Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Syndecan-4 Antibody

Western Blot: Syndecan-4 Antibody [NBP1-90173] - Analysis in control (vector only transfected HEK293T lysate) and SDC4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Syndecan-4 Antibody [NBP1-90173] - Staining of human cell line U-251 MG shows localization to plasma membrane & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Syndecan-4 Antibody [NBP1-90173] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Applications for Syndecan-4 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Syndecan-4

Syndecans are type I integral membrane proteoglycans that are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan-1 is an matrix receptor which binds to Collagens, Fibronectin and Thrombospondin. Syndecan-1 and Syndecan-3 interact with MK (midkine), a growth/differentiation factor involved in embryogenesis. Syndecan-2 is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations. Syndecan-4 functions cooperatively with integrins in the processes of cell spreading and focal adhesion assembly.

Alternate Names

Amphiglycan, Ryudocan, SDC4, Syndecan4

Gene Symbol

SDC4

Additional Syndecan-4 Products

Product Documents for Syndecan-4 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Syndecan-4 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...