Spike Antibody [Alexa Fluor® 488]
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-37898AF488
Discontinued Product
NBP3-37898AF488 has been discontinued.
View all Spike products.
Key Product Details
Species Reactivity
SARS-CoV
Applications
Western Blot, ELISA
Label
Alexa Fluor 488 (Excitation = 488 nm, Emission = 515-545 nm)
Antibody Source
Polyclonal Rabbit IgG
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of coronavirus Spike S1 (NP_828851.1).
Sequence:
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRG
Sequence:
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Applications for Spike Antibody [Alexa Fluor® 488]
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark.
Background: Spike
The Coronavirus Spike protein (S Protein) is one of four major structural proteins (S, M, E, N) present in each viral particle. Spike proteins are abundantly expressed on the surface forming its characteristic crown-like halo structure. The Spike protein is a highly glycosylated, type I transmembrane protein that plays a critical role in receptor recognition and host cell entry. There are two subunits, S1 and S2, that divide the protein roughly in half. Within the N-terminal S1 subunit is the N-terminal domain and receptor binding domain (Spike RBD protein). The Spike RBD binds to the host cell and undergoes several conformational changes and proteolysis leading to fusion of the virus particle to the host cell membrane allowing transfer of the nucleocapsid into the host cell cytoplasm. For SARS-CoV-2, the virus responsible for the COVID-19 pandemic, the Spike RBD tightly associates with human ACE-2. Recombinant SARS-CoV-2 proteins and antibodies that recognize these proteins are essential for studying the molecular mechanisms of the coronavirus life cycle.
Long Name
Spike Protein
Alternate Names
S Protein
Additional Spike Products
Product Documents for Spike Antibody [Alexa Fluor® 488]
Product Specific Notices for Spike Antibody [Alexa Fluor® 488]
Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...