Skip to main content

SOX9 Antibody (CL0639)

Catalog # NBP2-52943 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-52943
NBP2-52943-25ul

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2A Clone # CL0639

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Summary for SOX9 Antibody (CL0639)

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR

Epitope

SQRTHIKTEQLSPSH

Predicted Species

Rat (96%). Backed by our 100% Guarantee.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2A

Scientific Data Images for SOX9 Antibody (CL0639)

Western Blot: SOX9 Antibody (CL0639) [NBP2-52943] - 251 Cells transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-SOX9 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.
Immunohistochemistry-Paraffin: SOX9 Antibody (CL0639) [NBP2-52943] - Analysis in human cerebral cortex and liver tissues using NBP2-52943antibody. Corresponding SOX9 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: SOX9 Antibody (CL0639) [NBP2-52943] - Staining of U-251 cells using the anti-SOX9 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.

Applications for SOX9 Antibody (CL0639)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

2-10 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Published Applications

Read 1 publication using NBP2-52943 in the following applications:

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOX9

SOX9 is a member of the family of SOX (Sry-type highmobility group box) genes that were first identified on the basis of region with high homology to that of Sry (Sex determining region Y). SOX9 is a transcription factor with a high mobility group DNA-binding domain that is expressed in all prechondrocytic and chondrocytic cells during embryonic development in a pattern that close parallels that of the gene for type II collagen. SOX9 is important in neural crest formation, and is involved in regulating subsequent epithelial-mesenchymal transition and migration.

Long Name

Transcription Factor SOX9

Alternate Names

campomelic dysplasia, autosomal sex-reversal, CMD 1, CMD1, CMPD1, SRA1SRY (sex-determining region Y)-box 9 protein, SRY (sex determining region Y)-box 9, SRY-related HMG-box, gene 9, transcription factor SOX-9

Gene Symbol

SOX9

Product Documents for SOX9 Antibody (CL0639)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SOX9 Antibody (CL0639)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...