Skip to main content

Slit1 Antibody

Catalog # NBP2-84269 | Novus Biologicals a Bio-Techne Brand
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-84269-0.1ml

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Summary for Slit1 Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Slit1. Peptide sequence: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Slit1 Antibody

Western Blot: Slit1 Antibody [NBP2-84269] - WB Suggested Anti-SLIT1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Stomach
Immunohistochemistry: Slit1 Antibody [NBP2-84269] - Immunohistochemistry with SLIT1 GFP/ WT mouse gut tissue at an antibody concentration of 2.5 ug/ml using anti-SLIT1 antibody

Applications for Slit1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Slit1

SLIT-1 (also known as KIAA0813, MEGF4, multiple epidermal growth factor-like domains 4 and Slit homolog 1 protein) is a Slit protein. This protein is a ligand for the Roundabout (Robo) receptors and acts as guidance cues in axonal migration/navigation during neural development, at the ventral midline of the neural tube. Slit1 and Slit2 are essential for midline guidance in the forebrain by acting as repulsive signals preventing inappropriate midline crossing by axons projecting from the olfactory bulb. Each SLIT gene encodes a putative secreted protein, which contains conserved protein-protein interaction domains including leucine-rich repeats and epidermal growth factor-like motifs, similar to those of the Drosophila protein. In situ hybridization studies indicated that the rat SLIT-1 mRNA was specifically expressed in the neurons of fetal and adult forebrains. This data suggests that the SLIT genes form an evolutionarily conserved group in vertebrates and invertebrates, and that the mammalian SLIT proteins may participate in the formation and maintenance of the nervous and endocrine systems by protein-protein interactions. Alternative splicing isoforms have been identified for Slit1 protein.

Long Name

SLIT Homolog 1

Alternate Names

MEGF4, SLIL1

Gene Symbol

SLIT1

Product Documents for Slit1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Slit1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...