Skip to main content

SLC7A5/LAT1 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09988

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-09988-100ul

Key Product Details

Species Reactivity

Validated:

Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC7A5/LAT1 (NP_003477.4). Peptide sequence IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit SLC7A5/LAT1 Antibody - BSA Free (NBP3-09988) is a polyclonal antibody validated for use in WB. Anti-SLC7A5/LAT1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SLC7A5/LAT1 Antibody - BSA Free

Western Blot: SLC7A5/LAT1 Antibody [NBP3-09988]

Western Blot: SLC7A5/LAT1 Antibody [NBP3-09988]

Western Blot: SLC7A5/LAT1 Antibody [NBP3-09988] - Western blot analysis of SLC7A5/LAT1 in Mouse Brain lysates. Antibody dilution at 1.0ug/ml
SLC7A5/LAT1 Antibody - BSA Free

Western Blot: SLC7A5/LAT1 Antibody - BSA Free [NBP3-09988] -

Effect of GW501516 on BCAA transport and catabolic enzymes. (a and b) Effect of treatment with GW501516 (GW) at 1 μM for 24 hours on (a) absolute media BCAA content or (b) control mean-normalized (within each experiment) media BCAA content following 24-hour treatment. (c) Effect of GW at 1 μM for up to 24 hours on myotube mRNA expression of branched-chain aminotransferase 2 (Bcat2), branched-chain alpha-keto acid dehydrogenase (Bckdha), and 3-hydroxyisobutyrate dehydrogenase (Hibadh). (d) Effect of GW at 1 μM for 24 hours on myotube protein expression of large amino acid transporter 1 (LAT1), pBCKDHa (normalized to total BCKDHa), BCKDHa, and BCAT2. Notes: ∗ indicates p ≤ 0.05 between groups. Time course gene expression was analyzed using one-way ANOVA with Dunnett's correction for multiple comparisons. Target gene expression was normalized to tata binding protein (Tbp) using three replicates per group across two independent experiments with n = 5–6 for the final analysis. Protein expression and BCAA media content were analyzed using student's t-test. Western blots were performed using three replicates per group across two independent experiments with n = 6 for the final analysis. BCAA media content was performed using three replicates per group across two independent experiments with n = 6 for the final analysis with each analyte measured in triplicate. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/37325367), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SLC7A5/LAT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC7A5/LAT1

Mammalian cells have several amino acid transport systems. These systems have been defined by both activity and specific genes. L-type amino acid transporter 1 (LAT1) is a 12 membrane-spanning protein. LAT1 is a Na + -independent neutral amino acid transporter agency and essential for the transporter of large neutral amino acid such as Leucine, Isoleucine, and Valine through the plasma membrane. LAT1 has been proposed to be one of the major nutrient transport systems at the blood-brain barrier. Drugs such as L Dopa are transported by LAT1. LAT1 is thought to be up-regulated to support the high protein synthesis for cell growth in some tumor cell lines.

Long Name

Solute Carrier Family 7 Member 5

Alternate Names

4F2LC, CD98lc, E16, LAT1, MPE16, TA1

Gene Symbol

SLC7A5

Additional SLC7A5/LAT1 Products

Product Documents for SLC7A5/LAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC7A5/LAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...