Skip to main content

SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15668

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-15668-100ul
NBP3-15668-20ul

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5T7M2 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (NP_001036.1). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) (NBP3-15668) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] -

Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Confocal imaging of paraffin-embedded Human liver cancer tissue using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] -

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Western blot analysis of rat brain using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit .
Exposure time: 5s.
SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Immunoprecipitation: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] -

Immunoprecipitation: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Immunoprecipitation of SLC6A4/5-HTTLPR/Serotonin transporter from 500 ug extracts of HT-29 cells was performed using 2 ug of SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb . Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at a dilution of 1:1000.

Applications for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC6A4/5-HTTLPR

Serotonin transporter encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Long Name

Solute Carrier Family 6 Member 4

Alternate Names

5-HT Transporter, 5-HTT, 5-HTTLPR, 5HTTLPR, OCD1, Serotonin Transporter 1, SERT

Gene Symbol

SLC6A4

Additional SLC6A4/5-HTTLPR Products

Product Documents for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...